Description
LL-37 is a human cathelicidin antimicrobial peptide, sold by Pure Rawz for laboratory research. Every batch is tested for 99% purity or better, and it’s sold for laboratory research only.
LL-37 explained
LL-37 is the only cathelicidin antimicrobial peptide humans make. It’s 37 amino acids long and starts with two leucines, which is where the name comes from. It’s cut from a larger precursor protein, hCAP-18, and is found in white blood cells, skin and the lining of the airways and gut.
It’s amphipathic, with one charged face and one oily face, so it can sit in and disrupt bacterial membranes.
How it acts in research models
LL-37 has a positively charged face that’s drawn to the negatively charged membranes of bacteria. Once it’s there, its oily face pushes into the membrane and makes holes.
It does more than kill microbes. It binds bacterial endotoxin, recruits immune cells and stimulates new blood vessel growth, which ties it into wound healing studies.
Published LL-37 research
Lab work shows it kills a wide range of bacteria and some fungi and viruses in culture, and it also acts as a signaling molecule in inflammation and wound repair. Heilborn and colleagues reported in 2003 that it’s needed for normal re-epithelialization of human skin wounds in culture.
Human data are limited to small early-phase studies, for example on venous leg ulcers.
To read the original papers, start with this PubMed search for LL-37.
Options and prices
This listing is a single 5mg size, priced at $104.37.
Study design notes
Repair peptide research mostly uses injury models: tendon or ligament damage, skin wounds, gut lining injury or muscle strain. Healing time, tissue strength and histology are the usual endpoints.
Because injury models vary a lot between animals, labs use larger groups and blinded scoring. A sham-injury group helps separate the peptide’s effect from normal healing.
Typical endpoints include wound closure rate, tensile strength of repaired tissue, collagen deposition and new blood vessel counts on histology. Gut models often score ulcer size and lining thickness.
LL-37 product details
- Compound: LL-37
- Also known as: cathelicidin, CAP-18 fragment
- CAS number: 154947-66-7
- Molecular formula: C205H340N60O53
- Molar mass: 4,493.3 g/mol
- Structure: [LL-37, 37 aa]
- Class: human cathelicidin antimicrobial peptide
- Size: 5mg
- Purity: 99% or higher, verified by first- and third-party testing
- Use: laboratory research only
Quality and testing
We test each batch for identity and purity before it ships, using HPLC and mass spectrometry, with independent third-party checks on top of our own.
The batch number on the label matches the certificate of analysis. If your lab keeps paperwork on file, ask us for it and we’ll email it over.
How to store LL-37
Keep the container sealed at room temperature, away from heat, moisture and sunlight. Label the container with the opening date. It saves guesswork later.
Safe handling
Handle it the way you’d handle any research chemical: gloves, eye protection and a clean bench. Don’t eat or drink where you work with it.
Keep it out of reach of anyone who isn’t trained, and dispose of used syringes, vials and wipes according to your lab’s waste rules.
Related products
- BPC-157: BPC-157 is a 15-amino-acid peptide based on a fragment of body protection compound, a protein first found in gastric juice.
- ARA-290: ARA-290 (cibinetide) is an 11-amino-acid peptide based on a region of erythropoietin.
- BPC-157 + Osthole + Laxogenin Capsules, combining BPC-157 Arginine Salt, Osthole and Laxogenin
- VIP Peptide (Vasoactive Intestinal Peptide): Vasoactive intestinal peptide (VIP) is a 28-amino-acid neuropeptide found in the gut, brain and immune system.
- BPC-157 Arginine Salt: BPC-157 arginine salt is the same 15-amino-acid sequence as standard BPC-157, Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val, paired with arginine instead of acetate as the counter-ion.
For the wider range, visit our healing and recovery peptides sections.
Similar compounds compared
Chrysalin (TP-508): TP-508, also called Chrysalin, is a 23-amino-acid peptide taken from a non-enzyme region of human thrombin. It was developed by OrthoLogic.
ARA-290: ARA-290 (cibinetide) is an 11-amino-acid peptide based on a region of erythropoietin. It activates the tissue-protective receptor without stimulating red blood cell production.
LL-37 FAQ
Can it be used in people or animals?
No. It’s sold for laboratory research only and isn’t approved for human or veterinary use.
How should I store it?
Follow the storage section above. In short: cold and dark for freeze-dried vials, room temperature and dry for capsules, tablets, powders and liquids, unless the label says otherwise.
Is LL-37 in stock?
Yes. It’s in stock and ships from our warehouse after your order clears.
Does it come with a certificate of analysis?
Yes. Every batch is tested, and we’ll email the certificate of analysis for your batch number on request.
Buy LL-37 from Pure Rawz
LL-37 is in stock at $104.37. Add it to the cart and check out in a couple of minutes.
Need more for the same project? Have a look at our healing and recovery peptides and research peptides.
For laboratory research use only. Not for human or veterinary use. These statements have not been evaluated by the FDA.
Reviews
There are no reviews yet.